Free Delivery on orders over ₹499. Don’t miss discount.
-85%

Beautiful Indian Traditional Silver Plated Peacock Design Partywear Payal Pajeb Anklets For Women And Girls

Original price was: ₹999.00.Current price is: ₹149.00.
28 people are viewing this right now
Estimated Delivery:
01 - 08 Jun, 2025
Free Shipping & Returns:
On all orders over 99.00
Trust Badge
Guaranteed safe & secure checkout

Product details

Introduction to LC Imitation’s Beautiful Anklets

LC Imitation presents an exquisite collection of Indian traditional silver plated peacock design partywear payal pajeb anklets, meticulously crafted for women and girls. These anklets are a perfect blend of tradition and elegance, making them a must-have in every jewelry collection.

Intricate Peacock Design

The standout feature of these anklets is the intricate peacock design. The craftsmanship involved in creating the detailed peacock motif is truly remarkable, reflecting the rich cultural heritage of India. The delicate design ensures that these anklets are not only visually appealing but also a symbol of grace and sophistication.

Premium Quality Silver Plating

LC Imitation’s anklets are silver plated, ensuring a premium quality finish that enhances their overall look. The silver plating not only adds to the visual appeal but also provides durability, ensuring that the anklets retain their shine and elegance over time. These anklets are designed to be worn at various occasions, from festive celebrations to casual parties.

Versatile and Elegant Partywear

These Indian traditional anklets are versatile enough to complement a wide range of outfits. Whether you are dressing up for a wedding, a festive occasion, or a casual party, these anklets add a touch of elegance to your ensemble. Their timeless design ensures that they remain a cherished addition to your jewelry collection for years to come.

A Perfect Gift

LC Imitation’s beautiful Indian traditional silver plated peacock design partywear payal pajeb anklets make an ideal gift for women and girls. Their exquisite design and superior quality make them a thoughtful and cherished gift for any special occasion.

In conclusion, LC Imitation’s anklets are a perfect blend of tradition, elegance, and quality. Their intricate peacock design and premium silver plating make them a standout accessory for any occasion, ensuring that you step out in style and grace.

Quick Comparison

Beautiful Indian Traditional Silver Plated Peacock Design Partywear Payal Pajeb Anklets For Women And Girls removeIndian Traditional White Metal Anklets Payal Pair for Women Girls with Attached Ghungroo – Fashion Designer Barefoot Foot Imitation Jewellery removeBeautiful Indian Traditional Silver Plated Partywear Payal Pajeb Anklets For Women And Girls removeBeautiful Indian Traditional Silver Plated Partywear Payal Pajeb Anklets For Women And Girls removeBeautiful Indian Traditional Silver Plated Partywear Payal Pajeb Anklets For Women And Girls removeBeautiful Indian Traditional Silver Plated Partywear Payal Pajeb Anklets For Women And Girls remove
NameBeautiful Indian Traditional Silver Plated Peacock Design Partywear Payal Pajeb Anklets For Women And Girls removeIndian Traditional White Metal Anklets Payal Pair for Women Girls with Attached Ghungroo – Fashion Designer Barefoot Foot Imitation Jewellery removeBeautiful Indian Traditional Silver Plated Partywear Payal Pajeb Anklets For Women And Girls removeBeautiful Indian Traditional Silver Plated Partywear Payal Pajeb Anklets For Women And Girls removeBeautiful Indian Traditional Silver Plated Partywear Payal Pajeb Anklets For Women And Girls removeBeautiful Indian Traditional Silver Plated Partywear Payal Pajeb Anklets For Women And Girls remove
Image
SKUPEACOCKPYLWHITEMETALANKGREENPIPEANK1TAJJHLRANKDANAPYLBLACKCRSTLANK
Rating
Price
Original price was: ₹999.00.Current price is: ₹149.00.
Save 85%
Original price was: ₹999.00.Current price is: ₹349.00.
Save 65%
Original price was: ₹499.00.Current price is: ₹99.00.
Save 80%
Original price was: ₹999.00.Current price is: ₹249.00.
Save 75%
Original price was: ₹499.00.Current price is: ₹149.00.
Save 70%
Original price was: ₹249.00.Current price is: ₹99.00.
Save 60%
Add to cart

DimensionsN/AN/AN/AN/AN/AN/A
Shipping

Related products

Select the fields to be shown. Others will be hidden. Drag and drop to rearrange the order.
  • Image
  • Price
  • Add to cart
Click outside to hide the comparison bar
Compare